Lineage for d1sq4b_ (1sq4 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070015Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2070385Family b.82.1.11: YlbA-like [101979] (4 protein domains)
    Pfam PF05899; formerly pfam06038; duplication: consists of two germin-like domains
  6. 2070386Protein Glyoxylate-induced protein PA1140 [101982] (1 species)
  7. 2070387Species Pseudomonas aeruginosa [TaxId:287] [101983] (1 PDB entry)
  8. 2070389Domain d1sq4b_: 1sq4 B: [98963]
    structural genomics; NESG target PAR14
    complexed with scn

Details for d1sq4b_

PDB Entry: 1sq4 (more details), 2.7 Å

PDB Description: crystal structure of the putative glyoxylate induced protein from pseudomonas aeruginosa, northeast structural genomics target par14
PDB Compounds: (B:) Glyoxylate-induced Protein

SCOPe Domain Sequences for d1sq4b_:

Sequence, based on SEQRES records: (download)

>d1sq4b_ b.82.1.11 (B:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]}
kssyyaphgghpaqtelltdramfteayavipkgvmrdivtshlpfwdnmrmwviarpls
gfaetfsqyivelapnggsdkpeqdpnaeavlfvvegelsltlqgqvhamqpggyafipp
gadykvrnttgqhtrfhwirkhyqkvdgvplpeafvtneqdiqplvmpdtegrwsttrfv
dmsdmrhdmhvnivnfepggvipfaethvmehglyvlegkavyrlnqdwveveagdfmwl
rafcpqacysggpgrfryllykdvnrhmrltln

Sequence, based on observed residues (ATOM records): (download)

>d1sq4b_ b.82.1.11 (B:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]}
kssyyaphgghpadramfteayavipkgvmrdivtshlpfwdnmrmwviarplsgfaetf
sqyivelapnggsdkpeqdpnaeavlfvvegelsltlqgqvhamqpggyafippgadykv
rnttgqhtrfhwirkhyqkvdgvplpeafvtneqdiqplvmpdtegrwsttrfvdmsdmr
hdmhvnivnfepggvipfaethvmehglyvlegkavyrlnqdwveveagdfmwlrafcpq
acysggpgrfryllykdvnrhmrltln

SCOPe Domain Coordinates for d1sq4b_:

Click to download the PDB-style file with coordinates for d1sq4b_.
(The format of our PDB-style files is described here.)

Timeline for d1sq4b_: