Lineage for d1sq1a_ (1sq1 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009030Fold d.258: Chorismate synthase, AroC [103262] (1 superfamily)
    duplication: consists of two DCoH-like beta(2)-alpha-beta(2)-alpha structural repeats; 3 layers, beta/alpha/beta
  4. 3009031Superfamily d.258.1: Chorismate synthase, AroC [103263] (2 families) (S)
  5. 3009032Family d.258.1.1: Chorismate synthase, AroC [103264] (2 proteins)
    automatically mapped to Pfam PF01264
  6. 3009033Protein Chorismate synthase, AroC [103265] (7 species)
  7. 3009052Species Campylobacter jejuni [TaxId:197] [103268] (1 PDB entry)
  8. 3009053Domain d1sq1a_: 1sq1 A: [98961]
    structural genomics; NESG target BR19
    complexed with so4

Details for d1sq1a_

PDB Entry: 1sq1 (more details), 2.8 Å

PDB Description: crystal structure of the chorismate synthase from campylobacter jejuni, northeast structural genomics target br19
PDB Compounds: (A:) Chorismate synthase

SCOPe Domain Sequences for d1sq1a_:

Sequence, based on SEQRES records: (download)

>d1sq1a_ d.258.1.1 (A:) Chorismate synthase, AroC {Campylobacter jejuni [TaxId: 197]}
mntfgtrlkftsfgeshgvavgciidgmpagvkfdeeflqneldkrkggskfatprkesd
kaqvlsgvfegyttghpiaivvfnenahskdydnlkdlfrpahadftyfykygirdhrgg
grssaresvarvaggavaamllrefdicvqsgvfgvgtfvsnlkeeefdfefakkseifc
ldpklesdfkneilnarnskdsvgaavftkvsgmliglgevlydkldsklahalmginav
kaveigeginaskmrgscnndalkdgkflsnhsggilggisngenlilktyfkptpsifa
kqesidkfgnnlkfelkgrhdpcvgvrgsvvasamvrlvladclllnasanlnnlknayg

Sequence, based on observed residues (ATOM records): (download)

>d1sq1a_ d.258.1.1 (A:) Chorismate synthase, AroC {Campylobacter jejuni [TaxId: 197]}
mntfgtrlkftsfgeshgvavgciidgmpagvkfdeeflqneldkrkgdkaqvlsgvfeg
yttghpiaivvfsaresvarvaggavaamllrefdicvqsgvfgvgtfvsnlkeeefdfe
fakkseifcldpklesdfkneilnarnskdsvgaavftkvsgmliglgevlydkldskla
halmginavkaveigeginaskmrgscnndalkdgkflsnhsggilggisngenlilkty
fkptpgrhdpcvgvrgsvvasamvrlvladclllnasanlnnlknayg

SCOPe Domain Coordinates for d1sq1a_:

Click to download the PDB-style file with coordinates for d1sq1a_.
(The format of our PDB-style files is described here.)

Timeline for d1sq1a_: