SCOPe 2.06: Domain d1sq0b_: 1sq0 B:

Lineage for d1sq0b_ (1sq0 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins)
   this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain

6. Protein von Willebrand factor binding domain of glycoprotein Ib alpha [75143] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75144] (10 PDB entries)

8. Domain d1sq0b_: 1sq0 B: [98960]
   Other proteins in same PDB: d1sq0a_

Details for d1sq0b_

PDB Entry: 1sq0, 2.6 Å

PDB Description: crystal structure of the complex of the wild-type von willebrand factor a1 domain and glycoprotein ib alpha at 2.6 angstrom resolution

PDB Compounds: (B:) Platelet glycoprotein Ib alpha chain (Glycoprotein Ibalpha) (GP-Ib alpha) (GPIbA) (GPIb-alpha) (CD42B-alpha) (CD42B) [Contains: Glycocalicin]

SCOPe Domain Sequences for d1sq0b_:

Sequence; same for both SEQRES and ATOM records:

>d1sq0b_ c.10.2.7 (B:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}
hpicevskvashlevncdkrdltalppdlpkdttilhlsenllytfslatlmpytrltql
nldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal
rglgelqelylkgnelktlppglltptpkleklslanndltelpagllnglenldtlllq
enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqgvdvkamt
snvasvqcdnsdkfpvykypgkgcp

Timeline for d1sq0b_:

• d1sq0b_ first appeared in SCOP 1.67
  
• d1sq0b_ appears in SCOPe 2.05
  
• d1sq0b_ appears in SCOPe 2.07
  
• d1sq0b_ appears in the current release, SCOPe 2.08