Lineage for d1sq0a_ (1sq0 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144673Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2144674Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2144675Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)
  6. 2144796Protein von Willebrand factor A1 domain, vWA1 [53306] (2 species)
  7. 2144797Species Human (Homo sapiens) [TaxId:9606] [53307] (10 PDB entries)
  8. 2144804Domain d1sq0a_: 1sq0 A: [98959]
    Other proteins in same PDB: d1sq0b_
    complexed with platelet glycoprotein Ib alpha chain

Details for d1sq0a_

PDB Entry: 1sq0 (more details), 2.6 Å

PDB Description: crystal structure of the complex of the wild-type von willebrand factor a1 domain and glycoprotein ib alpha at 2.6 angstrom resolution
PDB Compounds: (A:) Von Willebrand factor (vWF) [Contains: Von Willebrand antigen II]

SCOPe Domain Sequences for d1sq0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sq0a_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]}
dfycsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyhdgshay
iglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllmasq
epqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvdeleq
qrdeivsylcdlapeapp

SCOPe Domain Coordinates for d1sq0a_:

Click to download the PDB-style file with coordinates for d1sq0a_.
(The format of our PDB-style files is described here.)

Timeline for d1sq0a_: