Lineage for d1sora_ (1sor A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024308Fold f.19: Aquaporin-like [81339] (1 superfamily)
    core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices
  4. 3024309Superfamily f.19.1: Aquaporin-like [81338] (2 families) (S)
  5. 3024310Family f.19.1.1: Aquaporin-like [56895] (5 proteins)
    duplication: consist of two similar structural parts
    automatically mapped to Pfam PF00230
  6. 3024329Protein Aquaporin-0 [103468] (2 species)
  7. 3024333Species Sheep (Ovis aries) [TaxId:9940] [103469] (2 PDB entries)
  8. 3024335Domain d1sora_: 1sor A: [98955]
    single-crystal electron diffraction structure

Details for d1sora_

PDB Entry: 1sor (more details), 3 Å

PDB Description: aquaporin-0 membrane junctions reveal the structure of a closed water pore
PDB Compounds: (A:) Aquaporin-0

SCOPe Domain Sequences for d1sora_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sora_ f.19.1.1 (A:) Aquaporin-0 {Sheep (Ovis aries) [TaxId: 9940]}
rsasfwraifaeffatlfyvffglgaslrwapgplhvlqvalafglalatlvqavghisg
ahvnpavtfaflvgsqmsllraicyvvaqllgavagaavlysvtppavrgnlalntlhpg
vsvgqativeifltlqfvlcifatyderrngrlgsvalavgfsltlghlfgmyytgagmn
parsfapailtrnftnhwvywvgpvigaglgsllydfllfprlksvserlsilkg

SCOPe Domain Coordinates for d1sora_:

Click to download the PDB-style file with coordinates for d1sora_.
(The format of our PDB-style files is described here.)

Timeline for d1sora_: