Lineage for d1sojg_ (1soj G:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450552Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 450553Superfamily a.211.1: HD-domain/PDEase-like [109604] (2 families) (S)
  5. 450559Family a.211.1.2: PDEase [48548] (6 proteins)
    multihelical; can be divided into three subdomains
    3',5'-cyclic-nucleotide phosphodiesterase, Pfam 00233
  6. 450603Protein cGMP-inhibited 3',5'-cyclic phosphodiesterase B, pde3b [101441] (1 species)
  7. 450604Species Human (Homo sapiens) [TaxId:9606] [101442] (2 PDB entries)
  8. 450615Domain d1sojg_: 1soj G: [98948]

Details for d1sojg_

PDB Entry: 1soj (more details), 2.9 Å

PDB Description: catalytic domain of human phosphodiesterase 3b in complex with ibmx

SCOP Domain Sequences for d1sojg_:

Sequence, based on SEQRES records: (download)

>d1sojg_ a.211.1.2 (G:) cGMP-inhibited 3',5'-cyclic phosphodiesterase B, pde3b {Human (Homo sapiens)}
ldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleifkiptq
qfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngcgtgnetdsdgr
inhgriayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnaflvatna
pqavlyndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailatdlkkh
fdflaefnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwtegivne
fyeqgdeeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqwleaee
dndtesgddedgeeldtedeemennlnpkpprrksrrrifcqlmhhltenhkiwk

Sequence, based on observed residues (ATOM records): (download)

>d1sojg_ a.211.1.2 (G:) cGMP-inhibited 3',5'-cyclic phosphodiesterase B, pde3b {Human (Homo sapiens)}
ldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleifkiptq
qfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngriayisskscsn
pdesygclssnipalelmalyvaaamhdydhpgrtnaflvatnapqavlyndrsvlenhh
aasawnlylsrpeynfllhldhvefkrfrflvieailatdlkkhfdflaefnakandvns
ngiewsnendrllvcqvcikladingpakvrdlhlkwtegivnefyeqgdeeanlglpis
pfmdrsspqlaklqesfithivgplcnsydaagllpgqwleaesrrrifcqlmhhltenh
kiwk

SCOP Domain Coordinates for d1sojg_:

Click to download the PDB-style file with coordinates for d1sojg_.
(The format of our PDB-style files is described here.)

Timeline for d1sojg_: