Lineage for d1sojd_ (1soj D:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780219Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 780220Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families) (S)
  5. 780284Family a.211.1.2: PDEase [48548] (6 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 780384Protein cGMP-inhibited 3',5'-cyclic phosphodiesterase B, pde3b [101441] (1 species)
  7. 780385Species Human (Homo sapiens) [TaxId:9606] [101442] (2 PDB entries)
  8. 780393Domain d1sojd_: 1soj D: [98945]

Details for d1sojd_

PDB Entry: 1soj (more details), 2.9 Å

PDB Description: catalytic domain of human phosphodiesterase 3b in complex with ibmx
PDB Compounds: (D:) cGMP-inhibited 3',5'-cyclic phosphodiesterase B

SCOP Domain Sequences for d1sojd_:

Sequence, based on SEQRES records: (download)

>d1sojd_ a.211.1.2 (D:) cGMP-inhibited 3',5'-cyclic phosphodiesterase B, pde3b {Human (Homo sapiens) [TaxId: 9606]}
evsldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleifki
ptqqfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngcgtgnetds
dgrinhgriayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnaflva
tnapqavlyndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailatdl
kkhfdflaefnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwtegi
vnefyeqgdeeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqwle
aeedndtesgddedgeeldtedeemennlnpkpprrksrrrifcqlmhhltenhkiwk

Sequence, based on observed residues (ATOM records): (download)

>d1sojd_ a.211.1.2 (D:) cGMP-inhibited 3',5'-cyclic phosphodiesterase B, pde3b {Human (Homo sapiens) [TaxId: 9606]}
evsldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleifki
ptqqfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngdgrinhgri
ayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnaflvatnapqavly
ndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailatdlkkhfdflae
fnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwtegivnefyeqgd
eeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqwleaeedndtes
srrrifcqlmhhltenhkiwk

SCOP Domain Coordinates for d1sojd_:

Click to download the PDB-style file with coordinates for d1sojd_.
(The format of our PDB-style files is described here.)

Timeline for d1sojd_: