Lineage for d1so2b_ (1so2 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2014926Family a.211.1.2: PDEase [48548] (7 protein domains)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2015103Protein cGMP-inhibited 3',5'-cyclic phosphodiesterase B, pde3b [101441] (1 species)
  7. 2015104Species Human (Homo sapiens) [TaxId:9606] [101442] (2 PDB entries)
  8. 2015106Domain d1so2b_: 1so2 B: [98937]
    complexed with 666, hg9, mg

Details for d1so2b_

PDB Entry: 1so2 (more details), 2.4 Å

PDB Description: catalytic domain of human phosphodiesterase 3b in complex with a dihydropyridazine inhibitor
PDB Compounds: (B:) cGMP-inhibited 3',5'-cyclic phosphodiesterase B

SCOPe Domain Sequences for d1so2b_:

Sequence, based on SEQRES records: (download)

>d1so2b_ a.211.1.2 (B:) cGMP-inhibited 3',5'-cyclic phosphodiesterase B, pde3b {Human (Homo sapiens) [TaxId: 9606]}
ldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleifkiptq
qfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngcgtgnetdsdgr
inhgriayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnaflvatna
pqavlyndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailatdlkkh
fdflaefnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwtegivne
fyeqgdeeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqwleaee
dndtesgddedgeeldtedeemennlnpkpprrksrrrifcqlmhhltenhkiwk

Sequence, based on observed residues (ATOM records): (download)

>d1so2b_ a.211.1.2 (B:) cGMP-inhibited 3',5'-cyclic phosphodiesterase B, pde3b {Human (Homo sapiens) [TaxId: 9606]}
ldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleifkiptq
qfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihnggriayisskscs
npdesygclssnipalelmalyvaaamhdydhpgrtnaflvatnapqavlyndrsvlenh
haasawnlylsrpeynfllhldhvefkrfrflvieailatdlkkhfdflaefnakandvn
sngiewsnendrllvcqvcikladingpakvrdlhlkwtegivnefyeqgdeeanlglpi
spfmdrsspqlaklqesfithivgplcnsydaagllpgqwlesrrrifcqlmhhltenhk
iwk

SCOPe Domain Coordinates for d1so2b_:

Click to download the PDB-style file with coordinates for d1so2b_.
(The format of our PDB-style files is described here.)

Timeline for d1so2b_: