Lineage for d1so2a_ (1so2 A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 360609Fold a.125: PDEase [48546] (1 superfamily)
    multihelical; can be divided into three subdomains
  4. 360610Superfamily a.125.1: PDEase [48547] (1 family) (S)
  5. 360611Family a.125.1.1: PDEase [48548] (4 proteins)
    3',5'-cyclic-nucleotide phosphodiesterase, Pfam 00233
  6. 360646Protein cGMP-inhibited 3',5'-cyclic phosphodiesterase B, pde3b [101441] (1 species)
  7. 360647Species Human (Homo sapiens) [TaxId:9606] [101442] (2 PDB entries)
  8. 360648Domain d1so2a_: 1so2 A: [98936]

Details for d1so2a_

PDB Entry: 1so2 (more details), 2.4 Å

PDB Description: catalytic domain of human phosphodiesterase 3b in complex with a dihydropyridazine inhibitor

SCOP Domain Sequences for d1so2a_:

Sequence, based on SEQRES records: (download)

>d1so2a_ a.125.1.1 (A:) cGMP-inhibited 3',5'-cyclic phosphodiesterase B, pde3b {Human (Homo sapiens)}
ldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleifkiptq
qfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihngcgtgnetdsdgr
inhgriayisskscsnpdesygclssnipalelmalyvaaamhdydhpgrtnaflvatna
pqavlyndrsvlenhhaasawnlylsrpeynfllhldhvefkrfrflvieailatdlkkh
fdflaefnakandvnsngiewsnendrllvcqvcikladingpakvrdlhlkwtegivne
fyeqgdeeanlglpispfmdrsspqlaklqesfithivgplcnsydaagllpgqwleaee
dndtesgddedgeeldtedeemennlnpkpprrksrrrifcqlmhhltenhkiwk

Sequence, based on observed residues (ATOM records): (download)

>d1so2a_ a.125.1.1 (A:) cGMP-inhibited 3',5'-cyclic phosphodiesterase B, pde3b {Human (Homo sapiens)}
ldlilveeydsliekmsnwnfpifelvekmgeksgrilsqvmytlfqdtglleifkiptq
qfmnyfralengyrdipyhnrihatdvlhavwylttrpvpglqqihnggriayisskscs
npdesygclssnipalelmalyvaaamhdydhpgrtnaflvatnapqavlyndrsvlenh
haasawnlylsrpeynfllhldhvefkrfrflvieailatdlkkhfdflaefnakandvn
sngiewsnendrllvcqvcikladingpakvrdlhlkwtegivnefyeqgdeeanlglpi
spfmdrsspqlaklqesfithivgplcnsydaagllpgqwlesrrrifcqlmhhltenhk
iwk

SCOP Domain Coordinates for d1so2a_:

Click to download the PDB-style file with coordinates for d1so2a_.
(The format of our PDB-style files is described here.)

Timeline for d1so2a_: