SCOPe 2.06: Domain d1snfb_: 1snf B:

Lineage for d1snfb_ (1snf B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)

7. Species Mycobacterium tuberculosis, rv2697c [TaxId:1773] [82213] (8 PDB entries)

8. Domain d1snfb_: 1snf B: [98928]
   complexed with mg, no3, trs, ump

Details for d1snfb_

PDB Entry: 1snf, 1.85 Å

PDB Description: mycobacterium tuberculosis dutpase complexed with magnesium and deoxyuridine 5'-monophosphate

PDB Compounds: (B:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d1snfb_:

Sequence; same for both SEQRES and ATOM records:

>d1snfb_ b.85.4.1 (B:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Mycobacterium tuberculosis, rv2697c [TaxId: 1773]}
msttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvavavpfgmvgl
vhprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdriaqllvqrve
lvelvevssfdeagla

Timeline for d1snfb_:

• d1snfb_ first appeared in SCOP 1.67
  
• d1snfb_ appears in SCOPe 2.05
  
• d1snfb_ appears in SCOPe 2.07
  
• d1snfb_ appears in the current release, SCOPe 2.08