Lineage for d1smcc_ (1smc C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2818071Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2818072Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 2818142Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)
  7. 2818185Species Mycobacterium tuberculosis, rv2697c [TaxId:1773] [82213] (8 PDB entries)
  8. 2818196Domain d1smcc_: 1smc C: [98922]
    Other proteins in same PDB: d1smcb2
    complexed with dut, no3, trs

Details for d1smcc_

PDB Entry: 1smc (more details), 2.1 Å

PDB Description: Mycobacterium tuberculosis dUTPase complexed with dUTP in the absence of metal ion.
PDB Compounds: (C:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d1smcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smcc_ b.85.4.1 (C:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Mycobacterium tuberculosis, rv2697c [TaxId: 1773]}
sttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvavavpfgmvglv
hprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdriaqllvqrvel
velvevssf

SCOPe Domain Coordinates for d1smcc_:

Click to download the PDB-style file with coordinates for d1smcc_.
(The format of our PDB-style files is described here.)

Timeline for d1smcc_: