SCOPe 2.06: Domain d1sm8a_: 1sm8 A:

Lineage for d1sm8a_ (1sm8 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)

7. Species Mycobacterium tuberculosis, rv2697c [TaxId:1773] [82213] (8 PDB entries)

8. Domain d1sm8a_: 1sm8 A: [98917]
   Other proteins in same PDB: d1sm8b2
   complexed with cr, dut, no3, trs

Details for d1sm8a_

PDB Entry: 1sm8, 2.9 Å

PDB Description: M. tuberculosis dUTPase complexed with chromium and dUTP

PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d1sm8a_:

Sequence; same for both SEQRES and ATOM records:

>d1sm8a_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Mycobacterium tuberculosis, rv2697c [TaxId: 1773]}
sttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvavavpfgmvglv
hprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdriaqllvqrvel
velvevssfde

Timeline for d1sm8a_:

• d1sm8a_ first appeared in SCOP 1.67
  
• d1sm8a_ appears in SCOPe 2.05
  
• d1sm8a_ appears in SCOPe 2.07
  
• d1sm8a_ appears in the current release, SCOPe 2.08