Lineage for d1sm8a_ (1sm8 A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 381897Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 381990Superfamily b.85.4: dUTPase-like [51283] (1 family) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 381991Family b.85.4.1: dUTPase-like [51284] (2 proteins)
  6. 382002Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (5 species)
  7. 382037Species Mycobacterium tuberculosis, rv2697c [TaxId:1773] [82213] (7 PDB entries)
  8. 382052Domain d1sm8a_: 1sm8 A: [98917]

Details for d1sm8a_

PDB Entry: 1sm8 (more details), 2.9 Å

PDB Description: M. tuberculosis dUTPase complexed with chromium and dUTP

SCOP Domain Sequences for d1sm8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sm8a_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Mycobacterium tuberculosis, rv2697c}
sttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvavavpfgmvglv
hprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdriaqllvqrvel
velvevssfde

SCOP Domain Coordinates for d1sm8a_:

Click to download the PDB-style file with coordinates for d1sm8a_.
(The format of our PDB-style files is described here.)

Timeline for d1sm8a_: