Lineage for d1slha_ (1slh A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2406647Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2406808Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2406809Family b.85.4.1: dUTPase-like [51284] (5 protein domains)
  6. 2406879Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)
  7. 2406922Species Mycobacterium tuberculosis, rv2697c [TaxId:1773] [82213] (8 PDB entries)
  8. 2406935Domain d1slha_: 1slh A: [98910]
    complexed with dud, mg, trs

Details for d1slha_

PDB Entry: 1slh (more details), 3 Å

PDB Description: Mycobacterium tuberculosis dUTPase complexed with magnesium and dUDP
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d1slha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1slha_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Mycobacterium tuberculosis, rv2697c [TaxId: 1773]}
sttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvavavpfgmvglv
hprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdriaqllvqrvel
velvevssfdeagla

SCOPe Domain Coordinates for d1slha_:

Click to download the PDB-style file with coordinates for d1slha_.
(The format of our PDB-style files is described here.)

Timeline for d1slha_: