Lineage for d1skud2 (1sku D:101-153)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 430156Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 430359Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family) (S)
  5. 430360Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 430361Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (1 species)
  7. 430362Species Escherichia coli [TaxId:562] [57828] (27 PDB entries)
  8. 430413Domain d1skud2: 1sku D:101-153 [98909]
    Other proteins in same PDB: d1skua1, d1skua2, d1skub1, d1skuc1, d1skuc2, d1skud1
    complexed with mli, zn; mutant

Details for d1skud2

PDB Entry: 1sku (more details), 2.6 Å

PDB Description: E. coli Aspartate Transcarbamylase 240's Loop Mutant (K244N)
PDB Compounds: (D:)

SCOP Domain Sequences for d1skud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1skud2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOP Domain Coordinates for d1skud2:

Click to download the PDB-style file with coordinates for d1skud2.
(The format of our PDB-style files is described here.)

Timeline for d1skud2: