Lineage for d1skud1 (1sku D:6-100)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412028Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) (S)
  5. 412029Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 412030Protein Aspartate carbamoyltransferase [54895] (1 species)
  7. 412031Species Escherichia coli [TaxId:562] [54896] (27 PDB entries)
  8. 412082Domain d1skud1: 1sku D:6-100 [98908]
    Other proteins in same PDB: d1skua1, d1skua2, d1skub2, d1skuc1, d1skuc2, d1skud2
    complexed with mli, zn; mutant

Details for d1skud1

PDB Entry: 1sku (more details), 2.6 Å

PDB Description: e. coli aspartate transcarbamylase 240's loop mutant (k244n)

SCOP Domain Sequences for d1skud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1skud1 d.58.2.1 (D:6-100) Aspartate carbamoyltransferase {Escherichia coli}
klqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientf
lsedqvdqlalyapqatvnridnyevvgksrpslp

SCOP Domain Coordinates for d1skud1:

Click to download the PDB-style file with coordinates for d1skud1.
(The format of our PDB-style files is described here.)

Timeline for d1skud1: