SCOPe 2.06: Domain d1skga_: 1skg A:

Lineage for d1skga_ (1skg A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Snake phospholipase A2 [48624] (38 species)

7. Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (38 PDB entries)
   Uniprot P59071

8. Domain d1skga_: 1skg A: [98901]
   complexed with moh, so4

Details for d1skga_

PDB Entry: 1skg, 1.21 Å

PDB Description: structure-based rational drug design: crystal structure of the complex formed between phospholipase a2 and a pentapeptide val-ala-phe-arg- ser

PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1skga_:

Sequence; same for both SEQRES and ATOM records:

>d1skga_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

Timeline for d1skga_:

• d1skga_ first appeared in SCOP 1.67
  
• d1skga_ appears in SCOPe 2.05
  
• d1skga_ appears in SCOPe 2.07
  
• d1skga_ appears in the current release, SCOPe 2.08