Lineage for d1skga_ (1skg A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015621Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2015622Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2015627Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2015739Protein Snake phospholipase A2 [48624] (38 species)
  7. 2015938Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (38 PDB entries)
    Uniprot P59071
  8. 2015941Domain d1skga_: 1skg A: [98901]
    complexed with moh, so4

Details for d1skga_

PDB Entry: 1skg (more details), 1.21 Å

PDB Description: structure-based rational drug design: crystal structure of the complex formed between phospholipase a2 and a pentapeptide val-ala-phe-arg- ser
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1skga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1skga_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOPe Domain Coordinates for d1skga_:

Click to download the PDB-style file with coordinates for d1skga_.
(The format of our PDB-style files is described here.)

Timeline for d1skga_: