Lineage for d1sjnb_ (1sjn B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2406647Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2406808Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2406809Family b.85.4.1: dUTPase-like [51284] (5 protein domains)
  6. 2406879Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)
  7. 2406922Species Mycobacterium tuberculosis, rv2697c [TaxId:1773] [82213] (8 PDB entries)
  8. 2406926Domain d1sjnb_: 1sjn B: [98897]
    complexed with dup, mg, no3, trs

Details for d1sjnb_

PDB Entry: 1sjn (more details), 1.8 Å

PDB Description: Mycobacterium tuberculosis dUTPase complexed with magnesium and alpha,beta-imido-dUTP
PDB Compounds: (B:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d1sjnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjnb_ b.85.4.1 (B:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Mycobacterium tuberculosis, rv2697c [TaxId: 1773]}
msttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvavavpfgmvgl
vhprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdriaqllvqrve
lvelvevssfdeaglastsr

SCOPe Domain Coordinates for d1sjnb_:

Click to download the PDB-style file with coordinates for d1sjnb_.
(The format of our PDB-style files is described here.)

Timeline for d1sjnb_: