Lineage for d1sjna_ (1sjn A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 964422Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 964543Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 964544Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 964595Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)
  7. 964647Species Mycobacterium tuberculosis, rv2697c [TaxId:1773] [82213] (8 PDB entries)
  8. 964650Domain d1sjna_: 1sjn A: [98896]
    complexed with dup, mg, no3, trs

Details for d1sjna_

PDB Entry: 1sjn (more details), 1.8 Å

PDB Description: Mycobacterium tuberculosis dUTPase complexed with magnesium and alpha,beta-imido-dUTP
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d1sjna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjna_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Mycobacterium tuberculosis, rv2697c [TaxId: 1773]}
sttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvavavpfgmvglv
hprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdriaqllvqrvel
velvevssfde

SCOPe Domain Coordinates for d1sjna_:

Click to download the PDB-style file with coordinates for d1sjna_.
(The format of our PDB-style files is described here.)

Timeline for d1sjna_: