| Class b: All beta proteins [48724] (174 folds) |
| Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) ![]() forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
| Family b.85.4.1: dUTPase-like [51284] (5 proteins) |
| Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species) |
| Species Mycobacterium tuberculosis, rv2697c [TaxId:1773] [82213] (8 PDB entries) |
| Domain d1sjna_: 1sjn A: [98896] complexed with dup, mg, no3, trs |
PDB Entry: 1sjn (more details), 1.8 Å
SCOPe Domain Sequences for d1sjna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sjna_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Mycobacterium tuberculosis, rv2697c [TaxId: 1773]}
sttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvavavpfgmvglv
hprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdriaqllvqrvel
velvevssfde
Timeline for d1sjna_: