Class b: All beta proteins [48724] (144 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (1 family) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.1: dUTPase-like [51284] (2 proteins) |
Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (5 species) |
Species Mycobacterium tuberculosis, rv2697c [TaxId:1773] [82213] (7 PDB entries) |
Domain d1sjna_: 1sjn A: [98896] |
PDB Entry: 1sjn (more details), 1.8 Å
SCOP Domain Sequences for d1sjna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sjna_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Mycobacterium tuberculosis, rv2697c} sttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvavavpfgmvglv hprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdriaqllvqrvel velvevssfde
Timeline for d1sjna_: