Lineage for d1sjjb_ (1sjj B:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3045007Fold i.15: Muscle protein complexes [64616] (1 superfamily)
  4. 3045008Superfamily i.15.1: Muscle protein complexes [64617] (1 family) (S)
  5. 3045009Family i.15.1.1: Muscle protein complexes [64618] (3 proteins)
  6. 3045010Protein Actinin [103679] (1 species)
  7. 3045011Species Chicken (Gallus gallus) [TaxId:9031] [103680] (1 PDB entry)
  8. 3045013Domain d1sjjb_: 1sjj B: [98895]
    cryo-EM structure

Details for d1sjjb_

PDB Entry: 1sjj (more details), 20 Å

PDB Description: cryo-em structure of chicken gizzard smooth muscle alpha-actinin
PDB Compounds: (B:) actinin

SCOPe Domain Sequences for d1sjjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjjb_ i.15.1.1 (B:) Actinin {Chicken (Gallus gallus) [TaxId: 9031]}
ldpawekqqrktftawcnshlrkagtqienieedfrdglklmlllevisgerlakpergk
mrvhkisnvnkaldfiaskgvklvsigaeeivdgnvkmtlgmiwtiilrfaiqdisveet
sakeglllwyqrktapyknvniqnfhiswkdglgfcalihrhrpelidygklrkddpltn
lntafdvaekyldipkmldaedivgtarpdekaimtyvssfyhafsgaqkaetaanrick
vlavnqeneqlmedyeklasdllewirrtipwlenrapentmqamqqkledfrdyrrlhk
ppkvqekcqleinfntlqtklrlsnrpafmpsegkmvsdinnawggleqaekgyeewlln
eirrlerldhlaekfrqkasiheswtdgkeamlqqkdyetatlseikallkkheafesdl
aahqdrveqiaaiaqelneldyydspsvnarcqkicdqwdnlgaltqkrrealertekll
etidqlyleyakraapfnnwmegamedlqdtfivhtieeiqglttaheqfkatlpdadke
rqailgihnevskivqtyhvnmagtnpyttitpqeingkwehvrqlvprrdqalmeehar
qqqnerlrkqfgaqanvigpwiqtkmeeigrisiemhgtledqlnhlrqyeksivnykpk
idqlegdhqqiqealifdnkhtnytmehirvgweqllttiartinevenqiltrdakgis
qeqmnefrasfnhfdrkktgmmdcedfraclismgynmgeaefarimsivdpnrmgvvtf
qafidfmsretadtdtadqvmasfkilagdknyitvdelrrelppdqaeyciarmapyng
rdavpgaldymsfstalygesdl

SCOPe Domain Coordinates for d1sjjb_:

Click to download the PDB-style file with coordinates for d1sjjb_.
(The format of our PDB-style files is described here.)

Timeline for d1sjjb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sjja_