Lineage for d1sjja_ (1sjj A:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2649582Fold i.15: Muscle protein complexes [64616] (1 superfamily)
  4. 2649583Superfamily i.15.1: Muscle protein complexes [64617] (1 family) (S)
  5. 2649584Family i.15.1.1: Muscle protein complexes [64618] (3 proteins)
  6. 2649585Protein Actinin [103679] (1 species)
  7. 2649586Species Chicken (Gallus gallus) [TaxId:9031] [103680] (1 PDB entry)
  8. 2649587Domain d1sjja_: 1sjj A: [98894]
    cryo-EM structure

Details for d1sjja_

PDB Entry: 1sjj (more details), 20 Å

PDB Description: cryo-em structure of chicken gizzard smooth muscle alpha-actinin
PDB Compounds: (A:) actinin

SCOPe Domain Sequences for d1sjja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sjja_ i.15.1.1 (A:) Actinin {Chicken (Gallus gallus) [TaxId: 9031]}
ldpawekqqrktftawcnshlrkagtqienieedfrdglklmlllevisgerlakpergk
mrvhkisnvnkaldfiaskgvklvsigaeeivdgnvkmtlgmiwtiilrfaiqdisveet
sakeglllwyqrktapyknvniqnfhiswkdglgfcalihrhrpelidygklrkddpltn
lntafdvaekyldipkmldaedivgtarpdekaimtyvssfyhafsgaqkaetaanrick
vlavnqeneqlmedyeklasdllewirrtipwlenrapentmqamqqkledfrdyrrlhk
ppkvqekcqleinfntlqtklrlsnrpafmpsegkmvsdinnawggleqaekgyeewlln
eirrlerldhlaekfrqkasiheswtdgkeamlqqkdyetatlseikallkkheafesdl
aahqdrveqiaaiaqelneldyydspsvnarcqkicdqwdnlgaltqkrrealertekll
etidqlyleyakraapfnnwmegamedlqdtfivhtieeiqglttaheqfkatlpdadke
rqailgihnevskivqtyhvnmagtnpyttitpqeingkwehvrqlvprrdqalmeehar
qqqnerlrkqfgaqanvigpwiqtkmeeigrisiemhgtledqlnhlrqyeksivnykpk
idqlegdhqqiqealifdnkhtnytmehirvgweqllttiartinevenqiltrdakgis
qeqmnefrasfnhfdrkktgmmdcedfraclismgynmgeaefarimsivdpnrmgvvtf
qafidfmsretadtdtadqvmasfkilagdknyitvdelrrelppdqaeyciarmapyng
rdavpgaldymsfstalygesdl

SCOPe Domain Coordinates for d1sjja_:

Click to download the PDB-style file with coordinates for d1sjja_.
(The format of our PDB-style files is described here.)

Timeline for d1sjja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sjjb_