Lineage for d1sixa_ (1six A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1332308Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1332444Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 1332445Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 1332515Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)
  7. 1332558Species Mycobacterium tuberculosis, rv2697c [TaxId:1773] [82213] (8 PDB entries)
  8. 1332559Domain d1sixa_: 1six A: [98892]
    complexed with dup, mg, trs

Details for d1sixa_

PDB Entry: 1six (more details), 1.3 Å

PDB Description: Mycobacterium tuberculosis dUTPase complexed with magnesium and alpha,beta-imido-dUTP
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d1sixa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sixa_ b.85.4.1 (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Mycobacterium tuberculosis, rv2697c [TaxId: 1773]}
sglvprgshmsttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvav
avpfgmvglvhprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdri
aqllvqrvelvelvevssfdeaglastsrgdgg

SCOPe Domain Coordinates for d1sixa_:

Click to download the PDB-style file with coordinates for d1sixa_.
(The format of our PDB-style files is described here.)

Timeline for d1sixa_: