Lineage for d1siua_ (1siu A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114950Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2114951Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2115256Family c.41.1.2: Serine-carboxyl proteinase, SCP [52764] (2 protein domains)
    elaborated with additional structures
  6. 2115257Protein Serine-carboxyl proteinase, SCP [52765] (3 species)
  7. 2115258Species Alicyclobacillus sendaiensis, kumamolisin-as [TaxId:192387] [102411] (3 PDB entries)
    Uniprot Q8GB88
  8. 2115263Domain d1siua_: 1siu A: [98891]
    complexed with ca, so4; mutant

Details for d1siua_

PDB Entry: 1siu (more details), 2.31 Å

PDB Description: kumamolisin-as e78h mutant
PDB Compounds: (A:) kumamolisin-As

SCOPe Domain Sequences for d1siua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1siua_ c.41.1.2 (A:) Serine-carboxyl proteinase, SCP {Alicyclobacillus sendaiensis, kumamolisin-as [TaxId: 192387]}
taytpldvaqayqfpegldgqgqciaiielgggydeaslaqyfaslgvpapqvvsvsvdg
asnqptgdpsgpdghveldievagalapgakfavyfapntdagfldaittaihdptlkps
vvsiswggpedswtsaaiaamnrafldaaalgvtvlaaagdsgstdgeqdglyhvdfpaa
spyvlacggtrlvasggriaqetvwndgpdggatgggvsrifplpawqehanvppsanpg
assgrgvpdlagnadpatgyevvidgeatviggtsavaplfaalvarinqklgkavgyln
ptlyqlpadvfhditegnndianraqiyqagpgwdpctglgspigvrllqallps

SCOPe Domain Coordinates for d1siua_:

Click to download the PDB-style file with coordinates for d1siua_.
(The format of our PDB-style files is described here.)

Timeline for d1siua_: