Lineage for d1si8c_ (1si8 C:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2620683Fold e.5: Heme-dependent catalase-like [56633] (1 superfamily)
    contains an (8,10) beta-barrel and an all-alpha domain
  4. 2620684Superfamily e.5.1: Heme-dependent catalase-like [56634] (3 families) (S)
  5. 2620685Family e.5.1.1: Heme-dependent catalases [56635] (3 proteins)
  6. 2620686Protein Catalase I [56636] (8 species)
  7. 2620713Species Enterococcus faecalis [TaxId:1351] [103393] (1 PDB entry)
  8. 2620716Domain d1si8c_: 1si8 C: [98886]
    complexed with cl, hem, so4

Details for d1si8c_

PDB Entry: 1si8 (more details), 2.3 Å

PDB Description: crystal structure of e. faecalis catalase
PDB Compounds: (C:) catalase

SCOPe Domain Sequences for d1si8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1si8c_ e.5.1.1 (C:) Catalase I {Enterococcus faecalis [TaxId: 1351]}
qhlttsqgspvgdnqnsltagefgpvliqdvhlleklahfnrervpervvhakgagahgi
fkvsqsmaqytkadflsevgketplfarfstvagelgssdtlrdprgfalkfytdegnyd
lvgnntpiffirdaikfpdfihsqkrnprthlkspeavwdfwshspeslhqvtilmsdrg
iplsfrhmhgfgshtfkwvnaagevffvkyhfktnqgiknlesqlaeeiagknpdfhied
lhnaienqefpswtlsvqiipyadaltmketlfdvtktvsqkeyplievgtmtlnrnpen
yfaeveqvtfspgnfvpgieaspdkllqgrlfaygdahrhrvganshqlpinqakapvnn
yqkdgnmrfnngnseinyepnsytetpkedptakissfevegnvgnysynqdhftqanal
ynllpseekenlinniaaslgqvknqeiiarqidlftrvnpeygarvaqaikqq

SCOPe Domain Coordinates for d1si8c_:

Click to download the PDB-style file with coordinates for d1si8c_.
(The format of our PDB-style files is described here.)

Timeline for d1si8c_: