Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins) |
Protein Viral RNA polymerase [56695] (17 species) |
Species Norwalk virus [TaxId:11983] [103400] (8 PDB entries) |
Domain d1sh3b_: 1sh3 B: [98880] complexed with mg missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1sh3 (more details), 2.95 Å
SCOPe Domain Sequences for d1sh3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sh3b_ e.8.1.4 (B:) Viral RNA polymerase {Norwalk virus [TaxId: 11983]} kgtycgapilgpgsapklstktkfwrsstaplppgtyepaylggkdprvkggpslqqvmr dqlkpfteprgkppkpsvleaakktiinvleqtidppdkwsfaqacasldkttssghphh mrkndcwngesftgkladqaskanlmfeegknmtpvytgalkdelvktdkiygkikkrll wgsdlatmircarafgglmdelkthcvtlpirvgmnmnedgpiiferhsryryhydadys rwdstqqravlaaaleimvkfssephlaqvvaedllspsvvdvgdftisineglpsgvpc tsqwnsiahwlltlcalsevtnlspdiiqanslfsfygddeivstdikldpekltaklke yglkptrpdktegplvisedlngltflrrtvtrdpagwfgkleqssilrqmywtrgpnhe dpsetmiphsqrpiqlmsllgeaalhgpafyskisklviaelkeggmdfyvprqepmfrw mrfsdlstwegdrnlapsfvned
Timeline for d1sh3b_: