Lineage for d1sh0a_ (1sh0 A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3017418Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 3017426Protein Viral RNA polymerase [56695] (17 species)
  7. 3017684Species Norwalk virus [TaxId:11983] [103400] (8 PDB entries)
  8. 3017689Domain d1sh0a_: 1sh0 A: [98876]
    missing some secondary structures that made up less than one-third of the common domain

Details for d1sh0a_

PDB Entry: 1sh0 (more details), 2.17 Å

PDB Description: Crystal Structure of Norwalk Virus Polymerase (Triclinic)
PDB Compounds: (A:) RNA polymerase

SCOPe Domain Sequences for d1sh0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sh0a_ e.8.1.4 (A:) Viral RNA polymerase {Norwalk virus [TaxId: 11983]}
gtycgapilgpgsapklstktkfwrsstaplppgtyepaylggkdprvkggpslqqvmrd
qlkpfteprgkppkpsvleaakktiinvleqtidppdkwsfaqacasldkttssghphhm
rkndcwngesftgkladqaskanlmfeegknmtpvytgalkdelvktdkiygkikkrllw
gsdlatmircarafgglmdelkthcvtlpirvgmnmnedgpiiferhsryryhydadysr
wdstqqravlaaaleimvkfssephlaqvvaedllspsvvdvgdftisineglpsgvpct
sqwnsiahwlltlcalsevtnlspdiiqanslfsfygddeivstdikldpekltaklkey
glkptrpdktegplvisedlngltflrrtvtrdpagwfgkleqssilrqmywtrgpnhed
psetmiphsqrpiqlmsllgeaalhgpafyskisklviaelkeggmdfyvprqepmfrwm
rfsdlstwegdrnlapsfvned

SCOPe Domain Coordinates for d1sh0a_:

Click to download the PDB-style file with coordinates for d1sh0a_.
(The format of our PDB-style files is described here.)

Timeline for d1sh0a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sh0b_