Lineage for d1sgza_ (1sgz A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 377363Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 377364Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 377776Family b.50.1.2: Pepsin-like [50646] (9 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 377826Protein beta-secretase (memapsin) [50671] (1 species)
  7. 377827Species Human (Homo sapiens) [TaxId:9606] [50672] (3 PDB entries)
  8. 377830Domain d1sgza_: 1sgz A: [98872]

Details for d1sgza_

PDB Entry: 1sgz (more details), 2 Å

PDB Description: Crystal Structure of Unbound Beta-Secretase Catalytic Domain.
PDB Compounds: (A:)

SCOP Domain Sequences for d1sgza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sgza_ b.50.1.2 (A:) beta-secretase (memapsin) {Human (Homo sapiens)}
gsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrql
sstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwe
gilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmii
ggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrl
pkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsf
ritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfav
sachvhdefrtaavegpfvtldmedcgyn

SCOP Domain Coordinates for d1sgza_:

Click to download the PDB-style file with coordinates for d1sgza_.
(The format of our PDB-style files is described here.)

Timeline for d1sgza_: