SCOP 1.69: Domain d1sgye_: 1sgy E:

Lineage for d1sgye_ (1sgy E:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (14 proteins)

6. Protein Protease B [50508] (1 species)

7. Species Streptomyces griseus, strain k1 [TaxId:1911] [50509] (20 PDB entries)
   Streptogrisin B

8. Domain d1sgye_: 1sgy E: [98870]
   Other proteins in same PDB: d1sgyi_

Details for d1sgye_

PDB Entry: 1sgy, 1.8 Å

PDB Description: tyr 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5

SCOP Domain Sequences for d1sgye_:

Sequence; same for both SEQRES and ATOM records:

>d1sgye_ b.47.1.1 (E:) Protease B {Streptomyces griseus, strain k1}
isggdaiysstgrcslgfnvrsgstyyfltaghctdgattwwansarttvlgttsgssfp
nndygivrytnttipkdgtvggqditsaanatvgmavtrrgsttgthsgsvtalnatvny
gggdvvygmirtnvcaepgdsggplysgtraigltsggsgncssggttffqpvtealsay
gvsvy

Timeline for d1sgye_:

• d1sgye_ first appeared in SCOP 1.67
  
• d1sgye_ appears in SCOP 1.71
  
• d1sgye_ appears in the current release, SCOPe 2.08