Lineage for d1sgvb2 (1sgv B:1-235)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1687861Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 1687862Superfamily d.265.1: Pseudouridine synthase [55120] (5 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 1687877Family d.265.1.2: Pseudouridine synthase II TruB [69746] (2 proteins)
    contains C-terminal PUA domain
  6. 1687878Protein Pseudouridine synthase II TruB [69747] (5 species)
  7. 1687885Species Mycobacterium tuberculosis [TaxId:1773] [103017] (1 PDB entry)
  8. 1687887Domain d1sgvb2: 1sgv B:1-235 [98861]
    Other proteins in same PDB: d1sgva1, d1sgvb1

Details for d1sgvb2

PDB Entry: 1sgv (more details), 1.9 Å

PDB Description: structure of trna psi55 pseudouridine synthase (trub)
PDB Compounds: (B:) tRNA pseudouridine synthase B

SCOPe Domain Sequences for d1sgvb2:

Sequence, based on SEQRES records: (download)

>d1sgvb2 d.265.1.2 (B:1-235) Pseudouridine synthase II TruB {Mycobacterium tuberculosis [TaxId: 1773]}
msatgpgivvidkpagmtshdvvgrcrrifatrrvghagtldpmatgvlvigieratkil
glltaapksyaatirlgqttstedaegqvlqsvpakhltieaidaamerlrgeirqvpss
vsaikvggrrayrlarqgrsvqlearpiridrfellaarrrdqlididveidcssgtyir
alardlgdalgvgghvtalrrtrvgrfeldqarslddlaerpalslsldeacllm

Sequence, based on observed residues (ATOM records): (download)

>d1sgvb2 d.265.1.2 (B:1-235) Pseudouridine synthase II TruB {Mycobacterium tuberculosis [TaxId: 1773]}
msatgpgivvidkpagmtshdvvgrcrrifatrrvghagtldpmatgvlvigieratkil
glltaapksyaatirlgqttstedaegqvlqsvpakhltieaidaamerlrsvqlearpi
ridrfellaarrrdqlididveidcssgtyiralardlgdalgvgghvtalrrtrvgrfe
ldqarslddlaerpalslsldeacllm

SCOPe Domain Coordinates for d1sgvb2:

Click to download the PDB-style file with coordinates for d1sgvb2.
(The format of our PDB-style files is described here.)

Timeline for d1sgvb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sgvb1