SCOPe 2.04: Domain d1sgvb2: 1sgv B:1-235

Lineage for d1sgvb2 (1sgv B:1-235)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.265.1: Pseudouridine synthase [55120] (5 families)
   the active site is the most conserved structural region of the superfamily and is located between the subdomains

5. Family d.265.1.2: Pseudouridine synthase II TruB [69746] (2 proteins)
   contains C-terminal PUA domain

6. Protein Pseudouridine synthase II TruB [69747] (5 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [103017] (1 PDB entry)

8. Domain d1sgvb2: 1sgv B:1-235 [98861]
   Other proteins in same PDB: d1sgva1, d1sgvb1

Details for d1sgvb2

PDB Entry: 1sgv, 1.9 Å

PDB Description: structure of trna psi55 pseudouridine synthase (trub)

PDB Compounds: (B:) tRNA pseudouridine synthase B

SCOPe Domain Sequences for d1sgvb2:

Sequence, based on SEQRES records:

>d1sgvb2 d.265.1.2 (B:1-235) Pseudouridine synthase II TruB {Mycobacterium tuberculosis [TaxId: 1773]}
msatgpgivvidkpagmtshdvvgrcrrifatrrvghagtldpmatgvlvigieratkil
glltaapksyaatirlgqttstedaegqvlqsvpakhltieaidaamerlrgeirqvpss
vsaikvggrrayrlarqgrsvqlearpiridrfellaarrrdqlididveidcssgtyir
alardlgdalgvgghvtalrrtrvgrfeldqarslddlaerpalslsldeacllm

Sequence, based on observed residues (ATOM records):

>d1sgvb2 d.265.1.2 (B:1-235) Pseudouridine synthase II TruB {Mycobacterium tuberculosis [TaxId: 1773]}
msatgpgivvidkpagmtshdvvgrcrrifatrrvghagtldpmatgvlvigieratkil
glltaapksyaatirlgqttstedaegqvlqsvpakhltieaidaamerlrsvqlearpi
ridrfellaarrrdqlididveidcssgtyiralardlgdalgvgghvtalrrtrvgrfe
ldqarslddlaerpalslsldeacllm

Timeline for d1sgvb2:

• d1sgvb2 first appeared in SCOP 1.67
  
• d1sgvb2 appears in SCOPe 2.03
  
• d1sgvb2 appears in SCOPe 2.05
  
• d1sgvb2 appears in the current release, SCOPe 2.08