![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.265: Pseudouridine synthase [100877] (1 superfamily) consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold |
![]() | Superfamily d.265.1: Pseudouridine synthase [55120] (5 families) ![]() the active site is the most conserved structural region of the superfamily and is located between the subdomains |
![]() | Family d.265.1.2: Pseudouridine synthase II TruB [69746] (2 proteins) contains C-terminal PUA domain |
![]() | Protein Pseudouridine synthase II TruB [69747] (5 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [103017] (2 PDB entries) |
![]() | Domain d1sgva2: 1sgv A:3-235 [98859] Other proteins in same PDB: d1sgva1, d1sgvb1 |
PDB Entry: 1sgv (more details), 1.9 Å
SCOPe Domain Sequences for d1sgva2:
Sequence, based on SEQRES records: (download)
>d1sgva2 d.265.1.2 (A:3-235) Pseudouridine synthase II TruB {Mycobacterium tuberculosis [TaxId: 1773]} atgpgivvidkpagmtshdvvgrcrrifatrrvghagtldpmatgvlvigieratkilgl ltaapksyaatirlgqttstedaegqvlqsvpakhltieaidaamerlrgeirqvpssvs aikvggrrayrlarqgrsvqlearpiridrfellaarrrdqlididveidcssgtyiral ardlgdalgvgghvtalrrtrvgrfeldqarslddlaerpalslsldeacllm
>d1sgva2 d.265.1.2 (A:3-235) Pseudouridine synthase II TruB {Mycobacterium tuberculosis [TaxId: 1773]} atgpgivvidkpagmtshdvvgrcrrifatrrvghagtldpmatgvlvigieratkilgl ltaapksyaatirlgqttstedaegqvlqsvpakhltieaidaamerlrgeilearpiri drfellaarrrdqlididveidcssgtyiralardlgdalgvgghvtalrrtrvgrfeld qarslddlaerpalslsldeacllm
Timeline for d1sgva2: