Lineage for d1sgva2 (1sgv A:3-235)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 516867Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 516868Superfamily d.265.1: Pseudouridine synthase [55120] (4 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 516874Family d.265.1.2: Pseudouridine synthase II TruB [69746] (1 protein)
    contains C-terminal PUA domain
  6. 516875Protein Pseudouridine synthase II TruB [69747] (3 species)
  7. 516879Species Mycobacterium tuberculosis [TaxId:1773] [103017] (1 PDB entry)
  8. 516880Domain d1sgva2: 1sgv A:3-235 [98859]
    Other proteins in same PDB: d1sgva1, d1sgvb1

Details for d1sgva2

PDB Entry: 1sgv (more details), 1.9 Å

PDB Description: structure of trna psi55 pseudouridine synthase (trub)

SCOP Domain Sequences for d1sgva2:

Sequence, based on SEQRES records: (download)

>d1sgva2 d.265.1.2 (A:3-235) Pseudouridine synthase II TruB {Mycobacterium tuberculosis}
atgpgivvidkpagmtshdvvgrcrrifatrrvghagtldpmatgvlvigieratkilgl
ltaapksyaatirlgqttstedaegqvlqsvpakhltieaidaamerlrgeirqvpssvs
aikvggrrayrlarqgrsvqlearpiridrfellaarrrdqlididveidcssgtyiral
ardlgdalgvgghvtalrrtrvgrfeldqarslddlaerpalslsldeacllm

Sequence, based on observed residues (ATOM records): (download)

>d1sgva2 d.265.1.2 (A:3-235) Pseudouridine synthase II TruB {Mycobacterium tuberculosis}
atgpgivvidkpagmtshdvvgrcrrifatrrvghagtldpmatgvlvigieratkilgl
ltaapksyaatirlgqttstedaegqvlqsvpakhltieaidaamerlrgeilearpiri
drfellaarrrdqlididveidcssgtyiralardlgdalgvgghvtalrrtrvgrfeld
qarslddlaerpalslsldeacllm

SCOP Domain Coordinates for d1sgva2:

Click to download the PDB-style file with coordinates for d1sgva2.
(The format of our PDB-style files is described here.)

Timeline for d1sgva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sgva1