![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies) alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet |
![]() | Superfamily d.82.3: Hypothetical protein c14orf129, hspc210 [103107] (1 family) ![]() |
![]() | Family d.82.3.1: Hypothetical protein c14orf129, hspc210 [103108] (1 protein) Pfam PF05303 |
![]() | Protein Hypothetical protein c14orf129, hspc210 [103109] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [103110] (1 PDB entry) |
![]() | Domain d1sgoa_: 1sgo A: [98857] structural genomics; NESG target HR969 |
PDB Entry: 1sgo (more details)
SCOPe Domain Sequences for d1sgoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sgoa_ d.82.3.1 (A:) Hypothetical protein c14orf129, hspc210 {Human (Homo sapiens) [TaxId: 9606]} metdcnpmelssmsgfeegselngfegtdmkdmrleaeavvndvlfavnnmfvskslrca ddvayinvetkernryclelteaglkvvgyafdqvddhlqtpyhetvyslldtlspayre afgnallqrlealkrdgqs
Timeline for d1sgoa_: