SCOPe 2.05: Domain d1sgoa_: 1sgo A:

Lineage for d1sgoa_ (1sgo A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
   alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet

4. Superfamily d.82.3: Hypothetical protein c14orf129, hspc210 [103107] (1 family)

5. Family d.82.3.1: Hypothetical protein c14orf129, hspc210 [103108] (1 protein)
   Pfam PF05303

6. Protein Hypothetical protein c14orf129, hspc210 [103109] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103110] (1 PDB entry)

8. Domain d1sgoa_: 1sgo A: [98857]
   structural genomics; NESG target HR969

Details for d1sgoa_

PDB Entry: 1sgo

PDB Description: nmr structure of the human c14orf129 gene product, hspc210. northeast structural genomics target hr969.

PDB Compounds: (A:) Protein C14orf129

SCOPe Domain Sequences for d1sgoa_:

Sequence; same for both SEQRES and ATOM records:

>d1sgoa_ d.82.3.1 (A:) Hypothetical protein c14orf129, hspc210 {Human (Homo sapiens) [TaxId: 9606]}
metdcnpmelssmsgfeegselngfegtdmkdmrleaeavvndvlfavnnmfvskslrca
ddvayinvetkernryclelteaglkvvgyafdqvddhlqtpyhetvyslldtlspayre
afgnallqrlealkrdgqs

Timeline for d1sgoa_:

• d1sgoa_ first appeared in SCOP 1.67
  
• d1sgoa_ appears in SCOPe 2.04
  
• d1sgoa_ appears in SCOPe 2.06
  
• d1sgoa_ appears in the current release, SCOPe 2.08