Lineage for d1sgoa_ (1sgo A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 414907Fold d.82: N domain of copper amine oxidase-like [55382] (3 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 414943Superfamily d.82.3: Hypothetical protein c14orf129, hspc210 [103107] (1 family) (S)
  5. 414944Family d.82.3.1: Hypothetical protein c14orf129, hspc210 [103108] (1 protein)
    Pfam 05303
  6. 414945Protein Hypothetical protein c14orf129, hspc210 [103109] (1 species)
  7. 414946Species Human (Homo sapiens) [TaxId:9606] [103110] (1 PDB entry)
  8. 414947Domain d1sgoa_: 1sgo A: [98857]
    structural genomics; NESG target HR969

Details for d1sgoa_

PDB Entry: 1sgo (more details)

PDB Description: nmr structure of the human c14orf129 gene product, hspc210. northeast structural genomics target hr969.

SCOP Domain Sequences for d1sgoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sgoa_ d.82.3.1 (A:) Hypothetical protein c14orf129, hspc210 {Human (Homo sapiens)}
metdcnpmelssmsgfeegselngfegtdmkdmrleaeavvndvlfavnnmfvskslrca
ddvayinvetkernryclelteaglkvvgyafdqvddhlqtpyhetvyslldtlspayre
afgnallqrlealkrdgqs

SCOP Domain Coordinates for d1sgoa_:

Click to download the PDB-style file with coordinates for d1sgoa_.
(The format of our PDB-style files is described here.)

Timeline for d1sgoa_: