SCOP 1.67: Domain d1sgei_: 1sge I:

Lineage for d1sgei_ (1sge I:)

1. Root: SCOP 1.67

2. Class g: Small proteins [56992] (72 folds)

3. Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)

4. Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families)
   conserved core consists of a helix and a loop crosslinked with two disulfides

5. Family g.68.1.1: Ovomucoid domain III-like [57468] (10 proteins)

6. Protein Ovomucoid domains [57469] (3 species)
   unless specified in the comment, the listed structures are of domain III

7. Species Turkey (Meleagris gallopavo) [TaxId:9103] [57470] (31 PDB entries)

8. Domain d1sgei_: 1sge I: [98854]
   Other proteins in same PDB: d1sgee_
   complexed with po4; mutant

Details for d1sgei_

PDB Entry: 1sge, 1.8 Å

PDB Description: glu 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5

SCOP Domain Sequences for d1sgei_:

Sequence; same for both SEQRES and ATOM records:

>d1sgei_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo)}
vdcseypkpacteeyrplcgsdnktygnkcnfcnavvesngtltlshfgkc

Timeline for d1sgei_:

• d1sgei_ is new in SCOP 1.67
  
• d1sgei_ appears in SCOP 1.69
  
• d1sgei_ appears in the current release, SCOPe 2.08