Lineage for d1sgde_ (1sgd E:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 561477Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 561478Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 561479Family b.47.1.1: Prokaryotic proteases [50495] (14 proteins)
  6. 561555Protein Protease B [50508] (1 species)
  7. 561556Species Streptomyces griseus, strain k1 [TaxId:1911] [50509] (20 PDB entries)
    Streptogrisin B
  8. 561567Domain d1sgde_: 1sgd E: [98851]
    Other proteins in same PDB: d1sgdi_
    complexed with po4; mutant

Details for d1sgde_

PDB Entry: 1sgd (more details), 1.8 Å

PDB Description: asp 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5

SCOP Domain Sequences for d1sgde_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sgde_ b.47.1.1 (E:) Protease B {Streptomyces griseus, strain k1}
isggdaiysstgrcslgfnvrsgstyyfltaghctdgattwwansarttvlgttsgssfp
nndygivrytnttipkdgtvggqditsaanatvgmavtrrgsttgthsgsvtalnatvny
gggdvvygmirtnvcaepgdsggplysgtraigltsggsgncssggttffqpvtealsay
gvsvy

SCOP Domain Coordinates for d1sgde_:

Click to download the PDB-style file with coordinates for d1sgde_.
(The format of our PDB-style files is described here.)

Timeline for d1sgde_: