Lineage for d1sgde_ (1sgd E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794586Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 2794672Protein Protease B [50508] (1 species)
  7. 2794673Species Streptomyces griseus, strain k1 [TaxId:1911] [50509] (20 PDB entries)
    Streptogrisin B
  8. 2794687Domain d1sgde_: 1sgd E: [98851]
    Other proteins in same PDB: d1sgdi_
    complexed with po4

Details for d1sgde_

PDB Entry: 1sgd (more details), 1.8 Å

PDB Description: asp 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5
PDB Compounds: (E:) Streptogrisin B

SCOPe Domain Sequences for d1sgde_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sgde_ b.47.1.1 (E:) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]}
isggdaiysstgrcslgfnvrsgstyyfltaghctdgattwwansarttvlgttsgssfp
nndygivrytnttipkdgtvggqditsaanatvgmavtrrgsttgthsgsvtalnatvny
gggdvvygmirtnvcaepgdsggplysgtraigltsggsgncssggttffqpvtealsay
gvsvy

SCOPe Domain Coordinates for d1sgde_:

Click to download the PDB-style file with coordinates for d1sgde_.
(The format of our PDB-style files is described here.)

Timeline for d1sgde_: