Lineage for d1sg3b1 (1sg3 B:1-187)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 370246Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 370247Superfamily b.18.1: Galactose-binding domain-like [49785] (21 families) (S)
  5. 370570Family b.18.1.22: Allantoicase repeat [101588] (1 protein)
  6. 370571Protein Allantoicase [101589] (1 species)
    duplication: tandem repeat of two similar domains
  7. 370572Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101590] (2 PDB entries)
    Yir029w
  8. 370577Domain d1sg3b1: 1sg3 B:1-187 [98849]

Details for d1sg3b1

PDB Entry: 1sg3 (more details), 2.6 Å

PDB Description: structure of allantoicase

SCOP Domain Sequences for d1sg3b1:

Sequence, based on SEQRES records: (download)

>d1sg3b1 b.18.1.22 (B:1-187) Allantoicase {Baker's yeast (Saccharomyces cerevisiae)}
mkffsladeaefksiiisknkavdvigsklggqvvsfsdewfasaenliqptapirdptr
fvhsgawydgwetrrhnemeydwviikmgvaaahiiggeidtaffngnhapfvsiealyd
egeegniveddsrwveivekfecgpsqrhlfvrgngltkerfthiklkmypdggiarfrl
ygrvvpp

Sequence, based on observed residues (ATOM records): (download)

>d1sg3b1 b.18.1.22 (B:1-187) Allantoicase {Baker's yeast (Saccharomyces cerevisiae)}
mkffsladeaefksiiisknkavdvigsklggqvvsfsdewfasaenliqptapirdwyd
gwetrrhnemeydwviikmgvaaahiiggeidtaffngnhapfvsiealydegeegnive
ddsrwveivekfecgpsqrhlfvrgngltkerfthiklkmypdggiarfrlygrvvpp

SCOP Domain Coordinates for d1sg3b1:

Click to download the PDB-style file with coordinates for d1sg3b1.
(The format of our PDB-style files is described here.)

Timeline for d1sg3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sg3b2