SCOPe 2.05: Domain d1sfsa_: 1sfs A:

Lineage for d1sfsa_ (1sfs A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.8: 1,4-beta-N-acetylmuraminidase [63912] (4 proteins)
   Glycosyl hydrolase family 25; probably have evolved from a type II chitinase ancestor
   permutation of the common fold; strand 8 is antiparallel to the rest of the barrel

6. Protein Unnamed hypothetical protein [102082] (1 species)
   homologue of BH2215 from the complete Bacillus halodurans genome

7. Species Bacillus stearothermophilus [TaxId:1422] [102083] (1 PDB entry)

8. Domain d1sfsa_: 1sfs A: [98846]
   structural genomics
   complexed with po4

Details for d1sfsa_

PDB Entry: 1sfs, 1.07 Å

PDB Description: 1.07 a crystal structure of an uncharacterized b. stearothermophilus protein

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d1sfsa_:

Sequence; same for both SEQRES and ATOM records:

>d1sfsa_ c.1.8.8 (A:) Unnamed hypothetical protein {Bacillus stearothermophilus [TaxId: 1422]}
giwgvdsaqvvtdqlfqcvrtelgypkfwgrylsevpnvsegltrdeivrirnygvkvlp
iynafreavgyangqvaarnavfharrlgipknkllfaniedffavdaawiaawvetlyp
tgyrpglyadptkgdfaaayceavsrnnqvavqaviwsaaprpgttkeqkapryqpaapp
csanvwvwqygrdaevcpvdtnladrrlldfly

Timeline for d1sfsa_:

• d1sfsa_ first appeared in SCOP 1.67
  
• d1sfsa_ appears in SCOPe 2.04
  
• d1sfsa_ appears in SCOPe 2.06
  
• d1sfsa_ appears in the current release, SCOPe 2.08