Lineage for d1sfsa_ (1sfs A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384382Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) (S)
  5. 385358Family c.1.8.8: 1,4-beta-N-acetylmuraminidase [63912] (3 proteins)
    Glycosyl hydrolase family 25; probably have evolved from a type II chitinase ancestor
    permutation of the common fold; strand 8 is antiparallel to the rest of the barrel
  6. 385366Protein Unnamed hypothetical protein [102082] (1 species)
    homologue of BH2215 from the complete Bacillus halodurans genome
  7. 385367Species Bacillus stearothermophilus [TaxId:1422] [102083] (1 PDB entry)
  8. 385368Domain d1sfsa_: 1sfs A: [98846]
    structural genomics
    complexed with po4

Details for d1sfsa_

PDB Entry: 1sfs (more details), 1.07 Å

PDB Description: 1.07 a crystal structure of an uncharacterized b. stearothermophilus protein

SCOP Domain Sequences for d1sfsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfsa_ c.1.8.8 (A:) Unnamed hypothetical protein {Bacillus stearothermophilus}
giwgvdsaqvvtdqlfqcvrtelgypkfwgrylsevpnvsegltrdeivrirnygvkvlp
iynafreavgyangqvaarnavfharrlgipknkllfaniedffavdaawiaawvetlyp
tgyrpglyadptkgdfaaayceavsrnnqvavqaviwsaaprpgttkeqkapryqpaapp
csanvwvwqygrdaevcpvdtnladrrlldfly

SCOP Domain Coordinates for d1sfsa_:

Click to download the PDB-style file with coordinates for d1sfsa_.
(The format of our PDB-style files is described here.)

Timeline for d1sfsa_: