SCOPe 2.03: Domain d1sezb2: 1sez B:330-441

Lineage for d1sezb2 (1sez B:330-441)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)

6. Protein Protoporphyrinogen oxidase [102804] (2 species)

7. Species Tobacco (Nicotiana tabacum) [TaxId:4097] [102805] (1 PDB entry)

8. Domain d1sezb2: 1sez B:330-441 [98825]
   Other proteins in same PDB: d1seza1, d1sezb1
   complexed with fad, omn, ton

Details for d1sezb2

PDB Entry: 1sez, 2.9 Å

PDB Description: Crystal Structure of Protoporphyrinogen IX Oxidase

PDB Compounds: (B:) Protoporphyrinogen oxidase, mitochondrial

SCOPe Domain Sequences for d1sezb2:

Sequence; same for both SEQRES and ATOM records:

>d1sezb2 d.16.1.5 (B:330-441) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
dyvplsvvittfkrenvkyplegfgvlvpskeqqhglktlgtlfssmmfpdrapnnvyly
ttfvggsrnrelakasrtelkeivtsdlkqllgaegeptyvnhlywskafpl

Timeline for d1sezb2:

• d1sezb2 first appeared in SCOP 1.67
  
• d1sezb2 appears in SCOPe 2.02
  
• d1sezb2 appears in SCOPe 2.04
  
• d1sezb2 appears in the current release, SCOPe 2.08