| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) ![]() N-terminal domain is beta/beta/alpha common fold |
| Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins) |
| Protein Protoporphyrinogen oxidase [102804] (2 species) |
| Species Tobacco (Nicotiana tabacum) [TaxId:4097] [102805] (1 PDB entry) |
| Domain d1sezb2: 1sez B:330-441 [98825] Other proteins in same PDB: d1seza1, d1sezb1 complexed with fad, omn, ton |
PDB Entry: 1sez (more details), 2.9 Å
SCOPe Domain Sequences for d1sezb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sezb2 d.16.1.5 (B:330-441) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
dyvplsvvittfkrenvkyplegfgvlvpskeqqhglktlgtlfssmmfpdrapnnvyly
ttfvggsrnrelakasrtelkeivtsdlkqllgaegeptyvnhlywskafpl
Timeline for d1sezb2: