Lineage for d1sezb1 (1sez B:13-329,B:442-497)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2096453Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2096454Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2096508Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 protein domains)
    C-terminal domain is alpha+beta is common for the family
  6. 2096793Protein Protoporphyrinogen oxidase [102183] (2 species)
  7. 2096799Species Tobacco (Nicotiana tabacum) [TaxId:4097] [102184] (1 PDB entry)
  8. 2096801Domain d1sezb1: 1sez B:13-329,B:442-497 [98824]
    Other proteins in same PDB: d1seza2, d1sezb2
    complexed with fad, omn, ton

Details for d1sezb1

PDB Entry: 1sez (more details), 2.9 Å

PDB Description: Crystal Structure of Protoporphyrinogen IX Oxidase
PDB Compounds: (B:) Protoporphyrinogen oxidase, mitochondrial

SCOPe Domain Sequences for d1sezb1:

Sequence, based on SEQRES records: (download)

>d1sezb1 c.3.1.2 (B:13-329,B:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
akrvavigagvsglaaayklkihglnvtvfeaegkaggklrsvsqdgliwdegantmtes
egdvtflidslglrekqqfplsqnkryiarngtpvllpsnpidliksnflstgsklqmll
epilwknkklsqvsdshesvsgffqrhfgkevvdylidpfvagtcggdpdslsmhhsfpe
lwnlekrfgsvilgairsklspknekkqgppktsankkrqrgsfsflggmqtltdaickd
lredelrlnsrvlelscsctedsaidswsiisasphkrqseeesfdavimtaplcdvksm
kiakrgnpfllnfipevXyghnydsvldaidkmeknlpglfyagnhrgglsvgkalssgc
naadlvisylesvs

Sequence, based on observed residues (ATOM records): (download)

>d1sezb1 c.3.1.2 (B:13-329,B:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
akrvavigagvsglaaayklkihglnvtvfeaegkaggklrsvsqdgliwdegantmtes
egdvtflidslglrekqqfplsqnkryiarngtpvllpsnpidliksnflstgsklqmll
epilwshesvsgffqrhfgkevvdylidpfvagtcggdpdslsmhhsfpelwnlekrfgs
vilgairsklsktsankkrqrgsfsflggmqtltdaickdlredelrlnsrvlelscsct
edsaidswsiisasphkrqseeesfdavimtaplcdvksmkiakrgnpfllnfipevXyg
hnydsvldaidkmeknlpglfyagnhrgglsvgkalssgcnaadlvisylesvs

SCOPe Domain Coordinates for d1sezb1:

Click to download the PDB-style file with coordinates for d1sezb1.
(The format of our PDB-style files is described here.)

Timeline for d1sezb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sezb2