Lineage for d1se9a_ (1se9 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2177213Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2177382Protein Hypothetical protein At3g01050 [102782] (1 species)
  7. 2177383Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [102783] (1 PDB entry)
  8. 2177384Domain d1se9a_: 1se9 A: [98821]

Details for d1se9a_

PDB Entry: 1se9 (more details)

PDB Description: structure of at3g01050, a ubiquitin-fold protein from arabidopsis thaliana
PDB Compounds: (A:) ubiquitin family

SCOPe Domain Sequences for d1se9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
eaevhnqleikfrltdgsdigpkafpdattvsalketvisewprekengpktvkevklis
agkvlensktvkdyrspvsnlagavttmhviiqapvtekek

SCOPe Domain Coordinates for d1se9a_:

Click to download the PDB-style file with coordinates for d1se9a_.
(The format of our PDB-style files is described here.)

Timeline for d1se9a_: