| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
| Protein Hypothetical protein At3g01050 [102782] (1 species) |
| Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [102783] (1 PDB entry) |
| Domain d1se9a_: 1se9 A: [98821] |
PDB Entry: 1se9 (more details)
SCOPe Domain Sequences for d1se9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
eaevhnqleikfrltdgsdigpkafpdattvsalketvisewprekengpktvkevklis
agkvlensktvkdyrspvsnlagavttmhviiqapvtekek
Timeline for d1se9a_: