SCOP 1.71: Domain d1se1c1: 1se1 C:9-121

Lineage for d1se1c1 (1se1 C:9-121)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (1 family)

5. Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74864] (1 protein)

6. Protein Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74865] (1 species)

7. Species Escherichia coli [TaxId:562] [74866] (4 PDB entries)

8. Domain d1se1c1: 1se1 C:9-121 [98819]
   Other proteins in same PDB: d1se1a2, d1se1b2, d1se1c2
   disulfide-linked complex with the C-terminal domain
   mutant

Details for d1se1c1

PDB Entry: 1se1, 2.85 Å

PDB Description: Crystal structure of the disulfide-linked complex between the N-terminal and C-terminal domain of the electron transfer catalyst DsbD

SCOP Domain Sequences for d1se1c1:

Sequence; same for both SEQRES and ATOM records:

>d1se1c1 b.1.17.1 (C:9-121) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Escherichia coli}
sqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvqlpqgvwhed
efygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvplse

Timeline for d1se1c1:

• d1se1c1 first appeared in SCOP 1.67
  
• d1se1c1 appears in SCOP 1.69
  
• d1se1c1 does not appear in SCOP 1.73