SCOP 1.71: Domain d1se1b2: 1se1 B:426-543

Lineage for d1se1b2 (1se1 B:426-543)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (16 families)

5. Family c.47.1.1: Thioltransferase [52834] (13 proteins)

6. Protein Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) [102435] (1 species)

7. Species Escherichia coli [TaxId:562] [102436] (2 PDB entries)

8. Domain d1se1b2: 1se1 B:426-543 [98818]
   Other proteins in same PDB: d1se1a1, d1se1b1, d1se1c1

Details for d1se1b2

PDB Entry: 1se1, 2.85 Å

PDB Description: Crystal structure of the disulfide-linked complex between the N-terminal and C-terminal domain of the electron transfer catalyst DsbD

SCOP Domain Sequences for d1se1b2:

Sequence; same for both SEQRES and ATOM records:

>d1se1b2 c.47.1.1 (B:426-543) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli}
qthlnftqiktvdelnqalveakgkpvmldlyadwcvaskefekytfsdpqvqkaladtv
llqanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlrd

Timeline for d1se1b2:

• d1se1b2 first appeared in SCOP 1.67
  
• d1se1b2 appears in SCOP 1.69
  
• d1se1b2 does not appear in SCOP 1.73