Lineage for d1se1b2 (1se1 B:426-543)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584500Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 584501Superfamily c.47.1: Thioredoxin-like [52833] (16 families) (S)
  5. 584502Family c.47.1.1: Thioltransferase [52834] (13 proteins)
  6. 584546Protein Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) [102435] (1 species)
  7. 584547Species Escherichia coli [TaxId:562] [102436] (2 PDB entries)
  8. 584551Domain d1se1b2: 1se1 B:426-543 [98818]
    Other proteins in same PDB: d1se1a1, d1se1b1, d1se1c1

Details for d1se1b2

PDB Entry: 1se1 (more details), 2.85 Å

PDB Description: Crystal structure of the disulfide-linked complex between the N-terminal and C-terminal domain of the electron transfer catalyst DsbD

SCOP Domain Sequences for d1se1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1se1b2 c.47.1.1 (B:426-543) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli}
qthlnftqiktvdelnqalveakgkpvmldlyadwcvaskefekytfsdpqvqkaladtv
llqanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlrd

SCOP Domain Coordinates for d1se1b2:

Click to download the PDB-style file with coordinates for d1se1b2.
(The format of our PDB-style files is described here.)

Timeline for d1se1b2: