Lineage for d1se1b1 (1se1 B:1-125)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 551974Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (1 family) (S)
  5. 551975Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74864] (1 protein)
  6. 551976Protein Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74865] (1 species)
  7. 551977Species Escherichia coli [TaxId:562] [74866] (4 PDB entries)
  8. 551982Domain d1se1b1: 1se1 B:1-125 [98817]
    Other proteins in same PDB: d1se1a2, d1se1b2, d1se1c2

Details for d1se1b1

PDB Entry: 1se1 (more details), 2.85 Å

PDB Description: Crystal structure of the disulfide-linked complex between the N-terminal and C-terminal domain of the electron transfer catalyst DsbD

SCOP Domain Sequences for d1se1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1se1b1 b.1.17.1 (B:1-125) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Escherichia coli}
glfdapgrsqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvql
pqgvwhedefygkseiyrdrltlpvtinqasagatltvtyqgsadagfcyppetktvpls
evvan

SCOP Domain Coordinates for d1se1b1:

Click to download the PDB-style file with coordinates for d1se1b1.
(The format of our PDB-style files is described here.)

Timeline for d1se1b1: