SCOPe 2.03: Domain d1sdx.1: 1sdx A:,E:

Lineage for d1sdx.1 (1sdx A:,E:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.2: Transferrin [53888] (4 proteins)
   further duplication: composed of two two-domain lobes

6. Protein Lactoferrin [53889] (6 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53891] (10 PDB entries)

8. Domain d1sdx.1: 1sdx A:,E: [98812]
   C-terminal lobe
   complexed with co3, so4, zn

Details for d1sdx.1

PDB Entry: 1sdx, 2.06 Å

PDB Description: crystal structure of the zinc saturated c-terminal half of bovine lactoferrin at 2.0 a resolution reveals two additional zinc binding sites

PDB Compounds: (A:) lactotransferrin, (E:) lactotransferrin

SCOPe Domain Sequences for d1sdx.1:

Sequence; same for both SEQRES and ATOM records:

>g1sdx.1 c.94.1.2 (A:,E:) Lactoferrin {Cow (Bos taurus) [TaxId: 9913]}
ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
ndnteclaklggrptyeeylgteyvtaianlkkcsXleaca

Timeline for d1sdx.1:

• d1sdx.1 first appeared in SCOP 1.67
  
• d1sdx.1 appears in SCOPe 2.02
  
• d1sdx.1 appears in SCOPe 2.04
  
• d1sdx.1 appears in the current release, SCOPe 2.08